Lineage for d2bapa1 (2bap A:135-435)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006858Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 protein domains)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
  6. 2006859Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 2006860Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 2006869Domain d2bapa1: 2bap A:135-435 [128242]

Details for d2bapa1

PDB Entry: 2bap (more details), 3.3 Å

PDB Description: crystal structure of the n-terminal mdia1 armadillo repeat region and dimerisation domain in complex with the mdia1 autoregulatory domain (dad)
PDB Compounds: (A:) Diaphanous protein homolog 1

SCOPe Domain Sequences for d2bapa1:

Sequence, based on SEQRES records: (download)

>d2bapa1 a.118.1.23 (A:135-435) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeke
etsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakll
salcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalit
paeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddi
rmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivl
h

Sequence, based on observed residues (ATOM records): (download)

>d2bapa1 a.118.1.23 (A:135-435) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeky
dsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcil
pqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeld
frvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemdd
fgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh

SCOPe Domain Coordinates for d2bapa1:

Click to download the PDB-style file with coordinates for d2bapa1.
(The format of our PDB-style files is described here.)

Timeline for d2bapa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bapb1