Lineage for d2banb_ (2ban B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3017298Protein automated matches [190211] (7 species)
    not a true protein
  7. 3017318Species Human immunodeficiency virus 1 [TaxId:11676] [186967] (7 PDB entries)
  8. 3017324Domain d2banb_: 2ban B: [128241]
    Other proteins in same PDB: d2bana1, d2bana2
    automated match to d1bqmb_
    complexed with 357, mn

Details for d2banb_

PDB Entry: 2ban (more details), 2.95 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r157208
PDB Compounds: (B:) Reverse transcriptase P51 SUBUNIT

SCOPe Domain Sequences for d2banb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2banb_ e.8.1.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

SCOPe Domain Coordinates for d2banb_:

Click to download the PDB-style file with coordinates for d2banb_.
(The format of our PDB-style files is described here.)

Timeline for d2banb_: