Lineage for d2b9zb1 (2b9z B:1-72)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267844Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1267945Superfamily a.30.8: FHV B2 protein-like [140506] (1 family) (S)
    automatically mapped to Pfam PF11473
  5. 1267946Family a.30.8.1: FHV B2 protein-like [140507] (1 protein)
  6. 1267947Protein B2 [140508] (1 species)
  7. 1267948Species Flock house virus, FHV [TaxId:12287] [140509] (3 PDB entries)
    Uniprot P68831 1-72! Uniprot P68831 2-71
  8. 1267954Domain d2b9zb1: 2b9z B:1-72 [128232]
    automatically matched to 2B9Z A:1-72

Details for d2b9zb1

PDB Entry: 2b9z (more details)

PDB Description: solution structure of fhv b2, a viral suppressor of rnai
PDB Compounds: (B:) B2 protein

SCOPe Domain Sequences for d2b9zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9zb1 a.30.8.1 (B:1-72) B2 {Flock house virus, FHV [TaxId: 12287]}
mpsklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvgrmvtsll
ekpsvvaylegk

SCOPe Domain Coordinates for d2b9zb1:

Click to download the PDB-style file with coordinates for d2b9zb1.
(The format of our PDB-style files is described here.)

Timeline for d2b9zb1: