Lineage for d2b9vp1 (2b9v P:435-666)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662303Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 662304Protein Alpha-amino acid ester hydrolase [89247] (2 species)
  7. 662305Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries)
  8. 662325Domain d2b9vp1: 2b9v P:435-666 [128229]
    Other proteins in same PDB: d2b9va2, d2b9vb2, d2b9vc2, d2b9vd2, d2b9ve2, d2b9vf2, d2b9vg2, d2b9vh2, d2b9vi2, d2b9vj2, d2b9vk2, d2b9vl2, d2b9vm2, d2b9vn2, d2b9vo2, d2b9vp2
    automatically matched to d1nx9a1

Details for d2b9vp1

PDB Entry: 2b9v (more details), 2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase
PDB Compounds: (P:) alpha-amino acid ester hydrolase

SCOP Domain Sequences for d2b9vp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9vp1 b.18.1.13 (P:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

SCOP Domain Coordinates for d2b9vp1:

Click to download the PDB-style file with coordinates for d2b9vp1.
(The format of our PDB-style files is described here.)

Timeline for d2b9vp1: