SCOP 1.73: Domain d2b9vl1: 2b9v L:435-666

Lineage for d2b9vl1 (2b9v L:435-666)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families)

5. Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)

6. Protein Alpha-amino acid ester hydrolase [89247] (2 species)

7. Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries)

8. Domain d2b9vl1: 2b9v L:435-666 [128221]
   Other proteins in same PDB: d2b9va2, d2b9vb2, d2b9vc2, d2b9vd2, d2b9ve2, d2b9vf2, d2b9vg2, d2b9vh2, d2b9vi2, d2b9vj2, d2b9vk2, d2b9vl2, d2b9vm2, d2b9vn2, d2b9vo2, d2b9vp2
   automatically matched to d1nx9a1

Details for d2b9vl1

PDB Entry: 2b9v, 2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase

PDB Compounds: (L:) alpha-amino acid ester hydrolase

SCOP Domain Sequences for d2b9vl1:

Sequence; same for both SEQRES and ATOM records:

>d2b9vl1 b.18.1.13 (L:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

Timeline for d2b9vl1:

• d2b9vl1 is new in SCOP 1.73
  
• d2b9vl1 appears in SCOP 1.75
  
• d2b9vl1 appears in the current release, SCOPe 2.08