Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
Protein Alpha-amino acid ester hydrolase [89247] (2 species) |
Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries) |
Domain d2b9vh1: 2b9v H:435-666 [128213] Other proteins in same PDB: d2b9va2, d2b9vb2, d2b9vc2, d2b9vd2, d2b9ve2, d2b9vf2, d2b9vg2, d2b9vh2, d2b9vi2, d2b9vj2, d2b9vk2, d2b9vl2, d2b9vm2, d2b9vn2, d2b9vo2, d2b9vp2 automated match to d2b9vd1 |
PDB Entry: 2b9v (more details), 2 Å
SCOPe Domain Sequences for d2b9vh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9vh1 b.18.1.13 (H:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk
Timeline for d2b9vh1:
View in 3D Domains from other chains: (mouse over for more information) d2b9va1, d2b9va2, d2b9vb1, d2b9vb2, d2b9vc1, d2b9vc2, d2b9vd1, d2b9vd2, d2b9ve1, d2b9ve2, d2b9vf1, d2b9vf2, d2b9vg1, d2b9vg2, d2b9vi1, d2b9vi2, d2b9vj1, d2b9vj2, d2b9vk1, d2b9vk2, d2b9vl1, d2b9vl2, d2b9vm1, d2b9vm2, d2b9vn1, d2b9vn2, d2b9vo1, d2b9vo2, d2b9vp1, d2b9vp2 |