Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries) Uniprot Q72I15 2-102 |
Domain d2b9py1: 2b9p Y:1-113 [128198] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9pz1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9py1:
Sequence, based on SEQRES records: (download)
>d2b9py1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
>d2b9py1 b.34.5.1 (Y:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
Timeline for d2b9py1: