Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries) Uniprot P12732 |
Domain d2b9px1: 2b9p X:1-78 [128197] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9py1, d2b9pz1 automatically matched to d1jj2r_ protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9px1:
Sequence, based on SEQRES records: (download)
>d2b9px1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqeva
>d2b9px1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge kkavvrlsedddqeva
Timeline for d2b9px1: