Lineage for d2b9pw1 (2b9p W:2-110)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1905952Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1905953Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1905954Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1905955Protein Ribosomal protein L22 [54845] (5 species)
  7. 1906056Species Thermus thermophilus [TaxId:274] [160267] (10 PDB entries)
  8. 1906066Domain d2b9pw1: 2b9p W:2-110 [128196]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pw1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (W:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2b9pw1:

Sequence, based on SEQRES records: (download)

>d2b9pw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

Sequence, based on observed residues (ATOM records): (download)

>d2b9pw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOPe Domain Coordinates for d2b9pw1:

Click to download the PDB-style file with coordinates for d2b9pw1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pw1: