![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (2 species) |
![]() | Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries) |
![]() | Domain d2b9pw1: 2b9p W:2-110 [128196] Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9px1, d2b9py1 automatically matched to d1bxea_ |
PDB Entry: 2b9p (more details), 6.46 Å
SCOP Domain Sequences for d2b9pw1:
Sequence, based on SEQRES records: (download)
>d2b9pw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
>d2b9pw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d2b9pw1: