SCOP 1.73: Domain d2b9pw1: 2b9p W:2-110

Lineage for d2b9pw1 (2b9p W:2-110)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (2 species)

7. Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries)

8. Domain d2b9pw1: 2b9p W:2-110 [128196]
   Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9px1, d2b9py1
   automatically matched to d1bxea_

Details for d2b9pw1

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (W:) 50S ribosomal protein L22

SCOP Domain Sequences for d2b9pw1:

Sequence, based on SEQRES records:

>d2b9pw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

Sequence, based on observed residues (ATOM records):

>d2b9pw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

Timeline for d2b9pw1:

• d2b9pw1 is new in SCOP 1.73
  
• d2b9pw1 appears in SCOP 1.75
  
• d2b9pw1 appears in the current release, SCOPe 2.08