Lineage for d2b9pt1 (2b9p T:4-56)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892653Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 892654Protein Ribosomal protein L24e [57750] (1 species)
  7. 892655Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 892699Domain d2b9pt1: 2b9p T:4-56 [128195]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    automatically matched to d1ffkr_

Details for d2b9pt1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOP Domain Sequences for d2b9pt1:

Sequence, based on SEQRES records: (download)

>d2b9pt1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Sequence, based on observed residues (ATOM records): (download)

>d2b9pt1 g.39.1.6 (T:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar

SCOP Domain Coordinates for d2b9pt1:

Click to download the PDB-style file with coordinates for d2b9pt1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pt1: