Lineage for d2b9pr1 (2b9p R:14-118)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238107Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 2238108Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 2238109Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 2238110Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 2238148Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 2238167Domain d2b9pr1: 2b9p R:14-118 [128194]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pr1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (R:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2b9pr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9pr1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2b9pr1:

Click to download the PDB-style file with coordinates for d2b9pr1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pr1: