Lineage for d2b9pr1 (2b9p R:14-118)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739448Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 739449Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 739450Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 739451Protein Prokaryotic ribosomal protein L17 [64265] (1 species)
  7. 739452Species Thermus thermophilus [TaxId:274] [64266] (5 PDB entries)
  8. 739465Domain d2b9pr1: 2b9p R:14-118 [128194]
    Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pt1, d2b9pw1, d2b9px1, d2b9py1
    automatically matched to d1gd8a_

Details for d2b9pr1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (R:) 50S ribosomal protein L17

SCOP Domain Sequences for d2b9pr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9pr1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOP Domain Coordinates for d2b9pr1:

Click to download the PDB-style file with coordinates for d2b9pr1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pr1: