Lineage for d2b9po1 (2b9p O:1-122)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949112Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 949113Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 949114Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 949115Protein Ribosomal protein L14 [50195] (5 species)
  7. 949116Species Bacillus stearothermophilus [TaxId:1422] [50196] (5 PDB entries)
  8. 949120Domain d2b9po1: 2b9p O:1-122 [128193]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    automatically matched to d1whi__
    protein/RNA complex

Details for d2b9po1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (O:) 50S ribosomal protein L14

SCOPe Domain Sequences for d2b9po1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9po1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOPe Domain Coordinates for d2b9po1:

Click to download the PDB-style file with coordinates for d2b9po1.
(The format of our PDB-style files is described here.)

Timeline for d2b9po1: