Class b: All beta proteins [48724] (165 folds) |
Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) |
Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
Protein Ribosomal protein L14 [50195] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50196] (5 PDB entries) |
Domain d2b9po1: 2b9p O:1-122 [128193] Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9pr1, d2b9pt1, d2b9pw1, d2b9px1, d2b9py1 automatically matched to d1whi__ |
PDB Entry: 2b9p (more details), 6.46 Å
SCOP Domain Sequences for d2b9po1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9po1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape vi
Timeline for d2b9po1: