SCOP 1.73: Domain d2b9pn1: 2b9p N:4-141

Lineage for d2b9pn1 (2b9p N:4-141)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (2 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)

8. Domain d2b9pn1: 2b9p N:4-141 [128192]
   Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9po1, d2b9pr1, d2b9pt1, d2b9pw1, d2b9px1, d2b9py1
   automatically matched to d1ffkg_

Details for d2b9pn1

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (N:) 50S ribosomal protein L13

SCOP Domain Sequences for d2b9pn1:

Sequence, based on SEQRES records:

>d2b9pn1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlga

Sequence, based on observed residues (ATOM records):

>d2b9pn1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga

Timeline for d2b9pn1:

• d2b9pn1 is new in SCOP 1.73
  
• d2b9pn1 appears in SCOP 1.75
  
• d2b9pn1 appears in the current release, SCOPe 2.08