Lineage for d2b9pk2 (2b9p K:8-70)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859768Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 859769Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 859770Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 859774Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 859810Species Thermotoga maritima [TaxId:2336] [54750] (6 PDB entries)
  8. 859816Domain d2b9pk2: 2b9p K:8-70 [128191]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    automatically matched to d1mmsa2

Details for d2b9pk2

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (K:) 50S ribosomal protein L11

SCOP Domain Sequences for d2b9pk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9pk2 d.47.1.1 (K:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

SCOP Domain Coordinates for d2b9pk2:

Click to download the PDB-style file with coordinates for d2b9pk2.
(The format of our PDB-style files is described here.)

Timeline for d2b9pk2: