Lineage for d2b9pi2 (2b9p I:1-55)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208185Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2208186Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2208187Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2208225Species Thermus thermophilus [TaxId:274] [143636] (9 PDB entries)
    Uniprot Q5SLQ1 1-55
  8. 2208234Domain d2b9pi2: 2b9p I:1-55 [128189]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pi2

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2b9pi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9pi2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Thermus thermophilus [TaxId: 274]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

SCOPe Domain Coordinates for d2b9pi2:

Click to download the PDB-style file with coordinates for d2b9pi2.
(The format of our PDB-style files is described here.)

Timeline for d2b9pi2: