SCOP 1.73: Domain d2b9pi2: 2b9p I:1-55

Lineage for d2b9pi2 (2b9p I:1-55)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.100: L9 N-domain-like [55657] (1 superfamily)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55661] (7 PDB entries)

8. Domain d2b9pi2: 2b9p I:1-55 [128189]
   Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pw1, d2b9px1, d2b9py1
   automatically matched to d1cqua_

Details for d2b9pi2

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2b9pi2:

Sequence; same for both SEQRES and ATOM records:

>d2b9pi2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

Timeline for d2b9pi2:

• d2b9pi2 is new in SCOP 1.73
  
• d2b9pi2 appears in SCOP 1.75
  
• d2b9pi2 appears in the current release, SCOPe 2.08