Lineage for d2b9pi1 (2b9p I:56-149)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208138Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 2208139Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
    automatically mapped to Pfam PF03948
  5. 2208140Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 2208141Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 2208174Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
    Uniprot Q5SLQ1 55-146
  8. 2208183Domain d2b9pi1: 2b9p I:56-149 [128188]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pi1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2b9pi1:

Sequence, based on SEQRES records: (download)

>d2b9pi1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records): (download)

>d2b9pi1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

SCOPe Domain Coordinates for d2b9pi1:

Click to download the PDB-style file with coordinates for d2b9pi1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pi1: