| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
| Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
| Protein Ribosomal protein L6 [56055] (2 species) duplication: consists of two domains of this fold |
| Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries) |
| Domain d2b9ph2: 2b9p H:82-170 [128187] Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pw1, d2b9px1, d2b9py1 automatically matched to d1rl6a2 |
PDB Entry: 2b9p (more details), 6.46 Å
SCOP Domain Sequences for d2b9ph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9ph2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl
Timeline for d2b9ph2: