SCOP 1.73: Domain d2b9ph2: 2b9p H:82-170

Lineage for d2b9ph2 (2b9p H:82-170)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries)

8. Domain d2b9ph2: 2b9p H:82-170 [128187]
   Other proteins in same PDB: d2b9p21, d2b9p31, d2b9pf1, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pw1, d2b9px1, d2b9py1
   automatically matched to d1rl6a2

Details for d2b9ph2

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d2b9ph2:

Sequence; same for both SEQRES and ATOM records:

>d2b9ph2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

Timeline for d2b9ph2:

• d2b9ph2 is new in SCOP 1.73
  
• d2b9ph2 appears in SCOP 1.75
  
• d2b9ph2 appears in the current release, SCOPe 2.08