Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries) Uniprot Q72I19 11-81! Uniprot Q72I19 82-170 |
Domain d2b9ph1: 2b9p H:7-81 [128186] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9ph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9ph1 d.141.1.1 (H:7-81) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt trsllanmvegvskg
Timeline for d2b9ph1: