Lineage for d2b9pf1 (2b9p F:1-246)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837604Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 1837605Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 1837606Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 1837607Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 1837690Species Thermus thermophilus [TaxId:274] [159476] (11 PDB entries)
    Uniprot Q5SHN9 1-208
  8. 1837701Domain d2b9pf1: 2b9p F:1-246 [128185]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pf1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOPe Domain Sequences for d2b9pf1:

Sequence, based on SEQRES records: (download)

>d2b9pf1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

Sequence, based on observed residues (ATOM records): (download)

>d2b9pf1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
meatiydntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaesfgs
grgqahrvpqavkgrsahppktekdrsldlndkerqlavrsalaatadvvvsddfedlvk
tqevvsllealdvhadidrlfvtsdepstaarnlagadvatasevntedlapgrltvfte
salaevaer

SCOPe Domain Coordinates for d2b9pf1:

Click to download the PDB-style file with coordinates for d2b9pf1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pf1: