Lineage for d2b9p21 (2b9p 2:1-65)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1718808Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1718809Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1718810Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1718894Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
    Uniprot Q5SHP6 12-62
  8. 1718904Domain d2b9p21: 2b9p 2:1-65 [128183]
    Other proteins in same PDB: d2b9p01, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9p21

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (2:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2b9p21:

Sequence, based on SEQRES records: (download)

>d2b9p21 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records): (download)

>d2b9p21 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

SCOPe Domain Coordinates for d2b9p21:

Click to download the PDB-style file with coordinates for d2b9p21.
(The format of our PDB-style files is described here.)

Timeline for d2b9p21: