Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) automatically mapped to Pfam PF01649 |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (2 species) |
Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
Domain d2b9ot1: 2b9o T:8-106 [128182] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ou1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9o (more details), 6.46 Å
SCOPe Domain Sequences for d2b9ot1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9ot1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d2b9ot1: