Lineage for d2b9oq1 (2b9o Q:2-105)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789396Protein Ribosomal protein S17 [50304] (3 species)
  7. 1789426Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 1789469Domain d2b9oq1: 2b9o Q:2-105 [128179]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1
    protein/RNA complex
    protein/RNA complex

Details for d2b9oq1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2b9oq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9oq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d2b9oq1:

Click to download the PDB-style file with coordinates for d2b9oq1.
(The format of our PDB-style files is described here.)

Timeline for d2b9oq1: