Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) automatically mapped to Pfam PF00333 |
Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
Domain d2b9oe2: 2b9o E:5-73 [128167] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9o (more details), 6.46 Å
SCOPe Domain Sequences for d2b9oe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9oe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d2b9oe2: