SCOP 1.73: Domain d2b9oe2: 2b9o E:5-73

Lineage for d2b9oe2 (2b9o E:5-73)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)

8. Domain d2b9oe2: 2b9o E:5-73 [128167]
   Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1
   automatically matched to d1i94e2
   complexed with psu, yyg

Details for d2b9oe2

PDB Entry: 2b9o, 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2b9oe2:

Sequence; same for both SEQRES and ATOM records:

>d2b9oe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d2b9oe2:

• d2b9oe2 is new in SCOP 1.73
  
• d2b9oe2 appears in SCOP 1.75
  
• d2b9oe2 appears in the current release, SCOPe 2.08