![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) Uniprot P27152 ! Uniprot P80373 |
![]() | Domain d2b9oe1: 2b9o E:74-154 [128166] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1, d2b9ou1 automatically matched to d1i94e1 protein/RNA complex |
PDB Entry: 2b9o (more details), 6.46 Å
SCOPe Domain Sequences for d2b9oe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9oe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d2b9oe1: