SCOP 1.73: Domain d2b9oe1: 2b9o E:74-154

Lineage for d2b9oe1 (2b9o E:74-154)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)

8. Domain d2b9oe1: 2b9o E:74-154 [128166]
   Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1
   automatically matched to d1i94e1
   complexed with psu, yyg

Details for d2b9oe1

PDB Entry: 2b9o, 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2b9oe1:

Sequence; same for both SEQRES and ATOM records:

>d2b9oe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2b9oe1:

• d2b9oe1 is new in SCOP 1.73
  
• d2b9oe1 appears in SCOP 1.75
  
• d2b9oe1 appears in the current release, SCOPe 2.08