SCOP 1.73: Domain d2b9oc1: 2b9o C:2-106

Lineage for d2b9oc1 (2b9o C:2-106)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)

8. Domain d2b9oc1: 2b9o C:2-106 [128163]
   Other proteins in same PDB: d2b9ob1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1
   automatically matched to d1fjgc1
   complexed with psu, yyg

Details for d2b9oc1

PDB Entry: 2b9o, 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2b9oc1:

Sequence; same for both SEQRES and ATOM records:

>d2b9oc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2b9oc1:

• d2b9oc1 is new in SCOP 1.73
  
• d2b9oc1 appears in SCOP 1.75
  
• d2b9oc1 appears in the current release, SCOPe 2.08