Lineage for d2b9nx1 (2b9n X:1-78)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016648Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1016649Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1016650Family d.12.1.1: L23p [54190] (1 protein)
  6. 1016651Protein Ribosomal protein L23 [54191] (4 species)
  7. 1016690Species Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
    Uniprot P12732
  8. 1016752Domain d2b9nx1: 2b9n X:1-78 [128160]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9ny1, d2b9nz1
    automatically matched to d1jj2r_

Details for d2b9nx1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (X:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2b9nx1:

Sequence, based on SEQRES records: (download)

>d2b9nx1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

Sequence, based on observed residues (ATOM records): (download)

>d2b9nx1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
kkavvrlsedddqeva

SCOPe Domain Coordinates for d2b9nx1:

Click to download the PDB-style file with coordinates for d2b9nx1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nx1: