Lineage for d2b9nh2 (2b9n H:82-170)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584865Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2584866Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2584867Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2584868Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2585023Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 2585051Domain d2b9nh2: 2b9n H:82-170 [128150]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9nh2

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2b9nh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nh2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

SCOPe Domain Coordinates for d2b9nh2:

Click to download the PDB-style file with coordinates for d2b9nh2.
(The format of our PDB-style files is described here.)

Timeline for d2b9nh2: