Lineage for d2b9nf1 (2b9n F:1-246)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982089Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 982090Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 982091Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 982092Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 982130Species Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries)
    Uniprot P12735
  8. 982176Domain d2b9nf1: 2b9n F:1-246 [128148]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to d1ffkc_

Details for d2b9nf1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOPe Domain Sequences for d2b9nf1:

Sequence, based on SEQRES records: (download)

>d2b9nf1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

Sequence, based on observed residues (ATOM records): (download)

>d2b9nf1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
meatiydntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaesfgs
grgqahrvpqavkgrsahppktekdrsldlndkerqlavrsalaatadvvvsddfedlvk
tqevvsllealdvhadidrlfvtsdepstaarnlagadvatasevntedlapgrltvfte
salaevaer

SCOPe Domain Coordinates for d2b9nf1:

Click to download the PDB-style file with coordinates for d2b9nf1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nf1: