![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() automatically mapped to Pfam PF00831 |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries) Uniprot Q5SHP6 12-62 |
![]() | Domain d2b9n21: 2b9n 2:1-65 [128146] Other proteins in same PDB: d2b9n01, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1 automatically matched to d1ffks_ |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9n21:
Sequence, based on SEQRES records: (download)
>d2b9n21 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
>d2b9n21 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]} tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg eegd
Timeline for d2b9n21: