Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (2 species) |
Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
Domain d2b9ms1: 2b9m S:2-81 [128144] Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9mt1, d2b9mu1 automatically matched to d1fjgs_ protein/RNA complex |
PDB Entry: 2b9m (more details), 6.76 Å
SCOPe Domain Sequences for d2b9ms1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9ms1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d2b9ms1: