Lineage for d2b9mr1 (2b9m R:16-88)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260595Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1260596Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1260597Protein Ribosomal protein S18 [46913] (2 species)
  7. 1260623Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1260669Domain d2b9mr1: 2b9m R:16-88 [128143]
    Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9ms1, d2b9mt1, d2b9mu1
    automatically matched to d1i94r_
    protein/RNA complex

Details for d2b9mr1

PDB Entry: 2b9m (more details), 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2b9mr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9mr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d2b9mr1:

Click to download the PDB-style file with coordinates for d2b9mr1.
(The format of our PDB-style files is described here.)

Timeline for d2b9mr1: