Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (1 species) |
Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) |
Domain d2b9mp1: 2b9m P:1-83 [128141] Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1 automatically matched to d1emwa_ complexed with psu, yyg |
PDB Entry: 2b9m (more details), 6.76 Å
SCOP Domain Sequences for d2b9mp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9mp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2b9mp1: