SCOPe 2.05: Domain d2b9mn1: 2b9m N:2-61

Lineage for d2b9mn1 (2b9m N:2-61)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2b9mn1: 2b9m N:2-61 [128139]
   Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1
   protein/RNA complex
   protein/RNA complex

Details for d2b9mn1

PDB Entry: 2b9m, 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2b9mn1:

Sequence; same for both SEQRES and ATOM records:

>d2b9mn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2b9mn1:

• d2b9mn1 first appeared in SCOP 1.73
  
• d2b9mn1 appears in SCOPe 2.04
  
• d2b9mn1 appears in SCOPe 2.06
  
• d2b9mn1 appears in the current release, SCOPe 2.08