Lineage for d2b9mn1 (2b9m N:2-61)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750502Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 750503Protein Ribosomal protein S14 [57753] (1 species)
  7. 750504Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)
  8. 750539Domain d2b9mn1: 2b9m N:2-61 [128139]
    Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1
    automatically matched to d1fjgn_
    complexed with psu, yyg

Details for d2b9mn1

PDB Entry: 2b9m (more details), 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2b9mn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9mn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d2b9mn1:

Click to download the PDB-style file with coordinates for d2b9mn1.
(The format of our PDB-style files is described here.)

Timeline for d2b9mn1: