Lineage for d2b9mk1 (2b9m K:11-129)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1860419Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 1860420Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1860510Protein Ribosomal protein S11 [53141] (2 species)
  7. 1860536Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 1860582Domain d2b9mk1: 2b9m K:11-129 [128136]
    Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1
    protein/RNA complex
    protein/RNA complex

Details for d2b9mk1

PDB Entry: 2b9m (more details), 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2b9mk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9mk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOPe Domain Coordinates for d2b9mk1:

Click to download the PDB-style file with coordinates for d2b9mk1.
(The format of our PDB-style files is described here.)

Timeline for d2b9mk1: