Lineage for d2b9mg1 (2b9m G:2-156)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644314Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 644315Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 644316Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 644317Protein Ribosomal protein S7 [47975] (3 species)
  7. 644322Species Thermus thermophilus [TaxId:274] [47977] (38 PDB entries)
  8. 644358Domain d2b9mg1: 2b9m G:2-156 [128132]
    Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me1, d2b9me2, d2b9mf1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1
    automatically matched to d1fjgg_
    complexed with psu, yyg

Details for d2b9mg1

PDB Entry: 2b9m (more details), 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d2b9mg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9mg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d2b9mg1:

Click to download the PDB-style file with coordinates for d2b9mg1.
(The format of our PDB-style files is described here.)

Timeline for d2b9mg1: