Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) Uniprot P27152 ! Uniprot P80373 |
Domain d2b9me1: 2b9m E:74-154 [128129] Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9md1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9m (more details), 6.76 Å
SCOPe Domain Sequences for d2b9me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9me1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d2b9me1: