SCOPe 2.08: Domain d2b9md1: 2b9m D:2-209

Lineage for d2b9md1 (2b9m D:2-209)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)

8. Domain d2b9md1: 2b9m D:2-209 [128128]
   Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1
   protein/RNA complex
   protein/RNA complex

Details for d2b9md1

PDB Entry: 2b9m, 6.76 Å

PDB Description: 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex. This file contains the 30S ribosomal subunit, tRNAs, mRNA and release factor RF2 from a crystal structure of the whole ribosomal complex". The entire crystal structure contains one 70S ribosome, tRNAs, mRNA and release factor RF2 and is described in remark 400.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2b9md1:

Sequence; same for both SEQRES and ATOM records:

>d2b9md1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

Timeline for d2b9md1:

• d2b9md1 first appeared in SCOP 1.73
  
• d2b9md1 appears in SCOPe 2.07