Lineage for d2b8td2 (2b8t D:150-219)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640792Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. 2640793Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
  7. 2640810Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries)
    Uniprot Q9PPP5 11-211
  8. 2640814Domain d2b8td2: 2b8t D:150-219 [128116]
    Other proteins in same PDB: d2b8ta1, d2b8tb1, d2b8tc1, d2b8td1
    automated match to d2b8ta2
    complexed with thm, trs, zn

Details for d2b8td2

PDB Entry: 2b8t (more details), 2 Å

PDB Description: crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
PDB Compounds: (D:) Thymidine kinase

SCOPe Domain Sequences for d2b8td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8td2 g.39.1.14 (D:150-219) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikffknkkr

SCOPe Domain Coordinates for d2b8td2:

Click to download the PDB-style file with coordinates for d2b8td2.
(The format of our PDB-style files is described here.)

Timeline for d2b8td2: