Lineage for d2b8td2 (2b8t D:150-216)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750616Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. 750617Protein Thymidine kinase, TK1, C-terminal domain [118277] (3 species)
  7. 750632Species Ureaplasma urealyticum [TaxId:2130] [118279] (2 PDB entries)
  8. 750636Domain d2b8td2: 2b8t D:150-216 [128116]
    Other proteins in same PDB: d2b8ta1, d2b8tb1, d2b8tc1, d2b8td1
    automatically matched to 2B8T A:150-216
    complexed with thm, trs, zn

Details for d2b8td2

PDB Entry: 2b8t (more details), 2 Å

PDB Description: crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
PDB Compounds: (D:) Thymidine kinase

SCOP Domain Sequences for d2b8td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8td2 g.39.1.14 (D:150-216) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikffkn

SCOP Domain Coordinates for d2b8td2:

Click to download the PDB-style file with coordinates for d2b8td2.
(The format of our PDB-style files is described here.)

Timeline for d2b8td2: