SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2b8qf1 (2b8q F:2-129)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2173865Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2173979Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)
    Uniprot Q5UQL3 2-137
  8. 2173985Domain d2b8qf1: 2b8q F:2-129 [128108]
    Other proteins in same PDB: d2b8qa2, d2b8qb2, d2b8qc2, d2b8qd2, d2b8qe2, d2b8qf2
    automatically matched to 2B8P A:2-129
    complexed with mg, po4, tyd

Details for d2b8qf1

PDB Entry: 2b8q (more details), 2.5 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with TDP
PDB Compounds: (F:) Probable nucleoside diphosphate kinase

SCOPe Domain Sequences for d2b8qf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8qf1 d.58.6.1 (F:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

SCOPe Domain Coordinates for d2b8qf1:

Click to download the PDB-style file with coordinates for d2b8qf1.
(The format of our PDB-style files is described here.)

Timeline for d2b8qf1: