| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Mimivirus [TaxId:315393] [143286] (2 PDB entries) Uniprot Q5UQL3 2-137 |
| Domain d2b8qf1: 2b8q F:2-129 [128108] Other proteins in same PDB: d2b8qa2, d2b8qb2, d2b8qc2, d2b8qd2, d2b8qe2, d2b8qf2 automatically matched to 2B8P A:2-129 complexed with mg, po4, tyd |
PDB Entry: 2b8q (more details), 2.5 Å
SCOPe Domain Sequences for d2b8qf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8qf1 d.58.6.1 (F:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp
Timeline for d2b8qf1: