Lineage for d2b8qa1 (2b8q A:2-129)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2558057Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)
    Uniprot Q5UQL3 2-137
  8. 2558058Domain d2b8qa1: 2b8q A:2-129 [128103]
    Other proteins in same PDB: d2b8qa2, d2b8qb2, d2b8qc2, d2b8qd2, d2b8qe2, d2b8qf2
    automatically matched to 2B8P A:2-129
    complexed with mg, po4, tyd

Details for d2b8qa1

PDB Entry: 2b8q (more details), 2.5 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with TDP
PDB Compounds: (A:) Probable nucleoside diphosphate kinase

SCOPe Domain Sequences for d2b8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

SCOPe Domain Coordinates for d2b8qa1:

Click to download the PDB-style file with coordinates for d2b8qa1.
(The format of our PDB-style files is described here.)

Timeline for d2b8qa1: