SCOPe 2.04: Domain d2b8qa1: 2b8q A:2-129

Lineage for d2b8qa1 (2b8q A:2-129)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)
   Uniprot Q5UQL3 2-137

8. Domain d2b8qa1: 2b8q A:2-129 [128103]
   automatically matched to 2B8P A:2-129
   complexed with mg, po4, tyd

Details for d2b8qa1

PDB Entry: 2b8q, 2.5 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with TDP

PDB Compounds: (A:) Probable nucleoside diphosphate kinase

SCOPe Domain Sequences for d2b8qa1:

Sequence; same for both SEQRES and ATOM records:

>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

Timeline for d2b8qa1:

• d2b8qa1 first appeared in SCOP 1.73
  
• d2b8qa1 appears in SCOPe 2.03
  
• d2b8qa1 appears in SCOPe 2.05
  
• d2b8qa1 appears in the current release, SCOPe 2.08