SCOP 1.73: Domain d2b8ot2: 2b8o T:109-209

Lineage for d2b8ot2 (2b8o T:109-209)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)

8. Domain d2b8ot2: 2b8o T:109-209 [128100]
   Other proteins in same PDB: d2b8oh1, d2b8ol1, d2b8ol2, d2b8ol3
   automatically matched to d1a21a2
   complexed with ca, cl, fuc, glc, mg, na, zn

Details for d2b8ot2

PDB Entry: 2b8o, 2.8 Å

PDB Description: crystal structure of glu-gly-arg-chloromethyl ketone-factor viia/soluble tissue factor complex

PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d2b8ot2:

Sequence, based on SEQRES records:

>d2b8ot2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Sequence, based on observed residues (ATOM records):

>d2b8ot2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywktaktntnef
lidvdkgenycfsvqavipsrtvnrkstdspvec

Timeline for d2b8ot2:

• d2b8ot2 is new in SCOP 1.73
  
• d2b8ot2 appears in SCOP 1.75
  
• d2b8ot2 appears in the current release, SCOPe 2.08